PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G183800.1
Common NamePHAVU_009G183800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 339aa    MW: 38017 Da    PI: 8.1361
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G183800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.33.6e-135799246
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                        +++T++E++l++++++  G++ W+ Ia+ ++ gRt++++k +w++
  Phvul.009G183800.1 57 DNFTAQEEDLIIKLHAAIGSR-WSIIAQQLP-GRTDNDVKIYWNT 99
                        68*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-8553IPR009057Homeodomain-like
PROSITE profilePS500904.716846IPR017877Myb-like domain
SMARTSM007175.81252IPR001005SANT/Myb domain
SuperFamilySSF466895.85E-2036109IPR009057Homeodomain-like
PROSITE profilePS5129421.13151105IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.7E-2254105IPR009057Homeodomain-like
SMARTSM007171.4E-1255103IPR001005SANT/Myb domain
CDDcd001671.49E-858101No hitNo description
PfamPF002496.7E-125899IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MVRSPCEKVN VKRGVWTTEE DTKKLAFGSK HGSGLKRCGK SCRLRWANCL RPDLKHDNFT  60
AQEEDLIIKL HAAIGSRWSI IAQQLPGRTD NDVKIYWNTK LKKKLSQMGI DPVTHKPFSK  120
LIADYGNIGG CQKPSARIGS INKEFKSAMM LKSEPHQTMP QGFTNINDQP KLPPQIETTG  180
NNFLFNRNHG DNLSMDLVQF QAIPKVSRAS NSIEFQNETI PGSVFGEDRL SKTSSPSTPS  240
TCSTSAFSWN DFLLEDAFTP LDYQEKDIIV SKNLVSQIEN VVTRQSWNNK EVKSQKALGS  300
DFQFSSSSDT SFIEAMLDQE NEMFLSFPHL MEEPSNLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-20131057108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150351e-124AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007138144.10.0hypothetical protein PHAVU_009G183800g
TrEMBLV7AZU80.0V7AZU8_PHAVU; Uncharacterized protein
STRINGGLYMA06G20020.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.12e-55myb domain protein 103